SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014670399.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014670399.1.21199
Domain Number 1 Region: 8-287
Classification Level Classification E-value
Superfamily LigB-like 2.88e-42
Family LigB-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014670399.1.21199
Sequence length 308
Comment MULTISPECIES: catecholic dioxygenase [Streptomyces]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MGEIVGAGLLAHVPTIVLPRETRLELNEGKEITLVTGLEQLREDVFERDDYDTVVVLDSH
WATTVEFVVTAQGRRAGLFTSEELPRGMCRMPYDFPGDPELARNIASFADRHGTWITAID
DEYLPVYYATINLWKFLGEGLPDKRWVTIGVCQTGDMEDHLRLGRALADGIAATPGRRVL
LIASGALSHTFWPLRELRDHESSDPAHIFTPEAREADCERIAWFKEGRHDKVLDTMDEFW
KYRPEARFFHYLMMAGALGEQACVARARQYGEYENSIGTGQVHLWFDRPADGWTGTGLPA
PRTPHSRI
Download sequence
Identical sequences A0A101QD48 H2JMZ5
gi|474980083|ref|YP_007690549.1| gi|386837874|ref|YP_006242932.1| WP_014670399.1.21199 WP_014670399.1.28171 WP_014670399.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]