SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014670759.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014670759.1.57224
Domain Number 1 Region: 66-243
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000341
Family Tetratricopeptide repeat (TPR) 0.057
Further Details:      
 
Weak hits

Sequence:  WP_014670759.1.57224
Domain Number - Region: 246-317
Classification Level Classification E-value
Superfamily TPR-like 0.000759
Family Transcription factor MalT domain III 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014670759.1.57224
Sequence length 346
Comment MULTISPECIES: hypothetical protein [Streptomyces]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MYGKAFAPEYQGTLTTLSVNSSLVDVLAAGTERLREAEHAGRPGEAARYGLAVAEAHRRL
GQVRDADRAWKASYRAAREAGDTAAMAWALWSGGTLARQRGAFPLAWRLLGLAAELGERG
GDVVVRGYSLAGLAETGRIQGDYAAVGRLHEQLLAEARERGEARHTVWALEGIAQMHRNT
GDYDRAYALFEEAAEIAGRADDRRGHAWALRGLADVLSVRDGATERALELLAEAEATCRE
MNLSSALAYNHKMQGNVLYRAGRHAEARERYELALGEFRAISEPRGEALSRLGLAKSLAR
LGRDRAETAAELADLARTLERSGLRHAREMVARAQREFGLDAEAVR
Download sequence
Identical sequences A0A117QE79 H2JTV4
gi|386838234|ref|YP_006243292.1| WP_014670759.1.21199 WP_014670759.1.28171 WP_014670759.1.57224 gi|474980443|ref|YP_007690909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]