SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014671047.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014671047.1.57224
Domain Number 1 Region: 43-551
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.57e-148
Family Quinoprotein alcohol dehydrogenase-like 0.0000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014671047.1.57224
Sequence length 569
Comment MULTISPECIES: PQQ-dependent dehydrogenase, methanol/ethanol family [Streptomyces]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MTVDYADYVDAGEAVDQGTLNYKTPGGDVAPPVVAGVDYERILNARQEPHNWLTYYGAYN
GQRYSPLDQINTENVKRMVPAWVFQAGTTGLIAGASTYSFEAAPIVVDGVMFLSGWDGWV
WALDAKTGVEIWRYKHAVPFDVSLCCGNVNRGVAVAQGKVFFVTANARVLALDATTGRRV
WDKTYGDVRAGESATLAPLVVKNMVIVGSSGGEFGVRGHLDAFDLETGEHQWRCYTVPKP
GEPGSETWPADGEAWARGGANCWITGTFDPETNLLYVGTGNPAPDFDGEVREGDNLFTDS
IIAVDVDSGQIRWHYQCTPHDVWDYDSIGECILFEKDGRKLLGHFDKNGYFFVLDRTNGA
RVGITPFVDRITWGAITRDGQVTAKVYPDKEGEPVHFYPGPAGAKEWTHASYSPKTELFY
VPVQDTGATATRRRREFKESIPYWGAGVQVDIEDMAGSVSAFDADGEEKWRWRNELPMCA
STLVTGGDLVFAGEASGEFNALDARTGELLWQFQCGSGHHSSPTTYMVDGRQYVAVPVGW
GGWAEGFLPGMLGAGHGSALIVFALPEPS
Download sequence
Identical sequences A0A0S2NV54 A0A101Q3T1 H2JZQ9
gi|474980731|ref|YP_007691197.1| gi|386838522|ref|YP_006243580.1| WP_014671047.1.21199 WP_014671047.1.28171 WP_014671047.1.57224 WP_014671047.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]