SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014671538.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014671538.1.57224
Domain Number 1 Region: 9-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-17
Family Nitrogenase iron protein-like 0.064
Further Details:      
 
Domain Number 2 Region: 388-578
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000425
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014671538.1.57224
Sequence length 695
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MAELATALGRARLVTVTGVGGVGKSRLAARVAARWASGGPAGAPGWGRVELSAVRDPQFV
EYAVVEALGLTDHTTRLPREALLEHLAGRRALLVLDGFEHLVAACADLTAELLRELPELR
VLAVGRRPLGLAGERLFPLAPLGEDEAAELFTDRARAQGVPVADGAEVRELCRRLEGIPL
ALELAAGRLRALSPAQLLRRLDDRFRLLTGGGRDVLPRHQTLRTTIGWSHELCSPDERLL
WARLSVFTHSFDLEAAEYVCSGDGLAAEDVLDVLSELLAQSVVSREETPAGPRYRMLDTV
RAYGAEWLEATGDAGRLRRRHRDWYLGLATLCELDWFSPRQREVAARVDAELPNLRTALE
FCLSEPEEAHLGQHLAGSLWFCWVGCGRLAEGRRWLERALELDSRYERSRLKALWVLGYV
AVLQGDTVAALRALRMCREQAERSADPTAVAYAEHRTGCLALVTDDMARAETLLRSALDR
YQEIGELNSNVLMGQVELAMTRAFQGDLPDAVRLCEDVRRVCEDHGERWARSYALYVLAY
AAWRGGDMVHARELLADCLDNAHGFHDLLGTVLSIELLALVTVTQGDPVEAAVLQGAAGR
MWPSVGLPLFGSAHYNAPHESCEAMAREALGDERYEEWVRRGARLDRETAVARALRKDGR
PLPALPAPRGPVPAARSGQREPAASPTLKGGETAG
Download sequence
Identical sequences H2JK65
gi|474981226|ref|YP_007691692.1| WP_014671538.1.21199 WP_014671538.1.57224 gi|386839017|ref|YP_006244075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]