SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014671639.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014671639.1.57224
Domain Number 1 Region: 215-401
Classification Level Classification E-value
Superfamily TPR-like 0.00000411
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014671639.1.57224
Sequence length 446
Comment MULTISPECIES: hypothetical protein [Streptomyces]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MQPNTLLDAILDEAGISHAGLAAHVNQAGRARGLALRYEHTAVARWLKGQRPRGQVPDLI
CEVLAARLRRPVTLDDIGLGVPGEPSTPHAGSLGGFVERATALWRSDEQQRPHVLGAPAV
TGTPAVMPVWEWENPPEDVDVSRGGRHPVTTADIEMLRAARTHYEQMYRKAGGVATRTRI
VGFLNAEAAPLLRGSYTDATGRQLHRATGGLVAIAGICAYDSDAHGLAQRYFHQALRLAK
ASGDRGLGAYVIALLVNQSLFMREYRQAVAFAEAALRAAGRHITPALASDLYAMQAKAYA
HLGDSGSALSCIRRAETAAERIRRGYEPDETGYVQPGLVNVQVAEALLSLGELAAAREHA
AAAVDNPAHDRGRVHRLAMLSTIELRQGNADKAVATAVRMAEQARGMESQRLRDRLRAVR
EHLVRCGSAGTAEAAELIDGALRVPL
Download sequence
Identical sequences A0A101PYL7 H2JLQ8
gi|386839119|ref|YP_006244177.1| WP_014671639.1.21199 WP_014671639.1.28171 WP_014671639.1.57224 gi|474981329|ref|YP_007691795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]