SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014671783.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014671783.1.57224
Domain Number 1 Region: 43-266
Classification Level Classification E-value
Superfamily TPR-like 4.05e-17
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 200-409
Classification Level Classification E-value
Superfamily TPR-like 0.000000161
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014671783.1.57224
Sequence length 425
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MAVALTGGAIALGADRVPASAPVPVGAADPGILGDGDLDASVAALQTHLRSQPKDAGAWA
TLALAYVEQARTKGDPSRYPRAEQALRRSLSLAPDGDQALAGRAALAAARHDFEDALAFA
DAALRRNPYSERALSSRIDALVELGRYADAAGAAKTADARRPGVPVFTRYAYVRELRGDV
TTARRVLEQALSAAGSPGDTAYVATQLGQLAWNQGDHKTALGCYARALAADDGYLPALEG
RARARAASGDRAGAITDMETVVARSPLPGPLVELGELYEARGAAGDRARARRQYALVGAW
TALARANGVDADLDTALAAADHGDKRAALRAARAEWARRHTVHTADALAWALHVNGRDAE
ALPYARRATATGYRSAVFRYHRGVIELATGHRAAGRASLASALALNPGFSPLGAARAREA
LEGAE
Download sequence
Identical sequences H2JPV8
WP_014671783.1.21199 WP_014671783.1.57224 gi|386839264|ref|YP_006244322.1| gi|474981473|ref|YP_007691939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]