SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014672275.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014672275.1.21199
Domain Number - Region: 381-473
Classification Level Classification E-value
Superfamily TPR-like 0.032
Family CT2138-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014672275.1.21199
Sequence length 488
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MTDRPAQRTPNRQLAALIAEAGFSNAGLARRVDQLGLEHGLDLRYDKTSVTRWLRGQQPR
GTTPALIAEVFTRRLGRRLTAQDLGLDACAPVYAGLEFAATPEEAVDIVSGLWRKDSGSH
AELRKIAFTPAGLVVPSRDWLIGKADDRVAREPVPRVPPQGRPGAARAPQPGPLVPPRLR
TPAERTPGHRVTGGDIAALHSVGELFRTLDDRFGGGHARQALVRYLEHECEPMLRGSYDE
QTGRRLFAAAADLTRLAGWTSYDIAAHGLAQRYFVQALRLAQAAGDRAYGSYVLVTMSRQ
AVYLGHGREAVQLARVAQQGVGTGAPPVVQALLHASEARAHGVLGEVRACTAALVRAERA
LEAARPGDEAPYWAAFFDEAQLADEFGHCHRDLQQFRAAAQHAERSLQLRAPAYARSRLF
CRVVLATARLGLGELDQACAIAAEAAGQAAEMRSARAVEYVQEFERRLEPYRDAAPVRVY
REKVAALG
Download sequence
Identical sequences H2JYH2
WP_014672275.1.21199 WP_014672275.1.57224 gi|386839758|ref|YP_006244816.1| gi|474981969|ref|YP_007692435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]