SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014672523.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014672523.1.57224
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-16
Family Prokaryotic proteases 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014672523.1.57224
Sequence length 581
Comment MULTISPECIES: serine protease [Streptomyces]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MMRGAAWQARIACGDAVGAGFLVTGRRLLTCAHVVRWSDRAAVTVTFPHARELGALSASV
VAHGGWAGGVTDPGDVAVLELDRDVPLAPAGFAPPDTAYTEPYPRLVAYGFPEGYDEGTL
AECQPVSGQLIAGEWLELVAWQGHGQPLVDGFSGAAATLPDGRVAGMVTAAVGSSPDVRK
GRMLPLDVLARYWPELGELVPTPGHRDDARRRLYALLRRAAAAAGPVGDPNRLYVDAVGA
FGPPLPPGGFPSLWDAAAYVQWEVPDPQAVSRFADRLLELLDPEAVSRAPAAPDTPAPAG
TPAAPAWSPVVVEIDHSGAGPDQVTVEVSAYRDGRRRPVGARRLPRTGVRAYVQSRIDEA
VAHLAPDADELVTFVLPREWLNEAVAHWECGADDSTPLGCAYPLVVTDRARHHSGRLRHQ
LRKKWQKLDSGGGVEVHRVECGTRERPPSLRKRLWDGDAGVAGYAAPPAAARQHFEVGLT
VPVPVLLWPRTGSPCAGHEEASGTDTAPGEPPCPGAAFLDQLAASVAGVPPAELPRHVLS
LRLTADAAEEPDRHWARDLQLLWDDPRCFPETTASLHSPVA
Download sequence
Identical sequences A0A101QMF7 H2K3H0
gi|386840006|ref|YP_006245064.1| WP_014672523.1.21199 WP_014672523.1.28171 WP_014672523.1.57224 gi|474982217|ref|YP_007692683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]