SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014675069.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014675069.1.21199
Domain Number 1 Region: 72-169
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000187
Family Tetratricopeptide repeat (TPR) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014675069.1.21199
Sequence length 170
Comment tetratricopeptide repeat protein [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MVPGGVLFVDLHGYDDAPVTADQALQSLLRALGAGPEHAWLDRERAGLVAAVHWAREGKH
VDTAMRLALCLSGYLRWRRHFDDAIGVGSAAQKAAHAIGNRRCQAMAWNNLGVALHESGR
VDEAIAAHLRNRDLCRDLGDRQGEAEAWHNLGNALAAKGQIDQAMEAYDP
Download sequence
Identical sequences H2K5U3
gi|474984800|ref|YP_007695266.1| gi|386842591|ref|YP_006247649.1| WP_014675069.1.21199 WP_014675069.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]