SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014675343.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014675343.1.21199
Domain Number 1 Region: 38-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000253
Family APH phosphotransferases 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014675343.1.21199
Sequence length 299
Comment kinase [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MAFEPPQRLVRALGETAPAGDDWLARLPAAAERAVARRELTVERVQVPGGRSSLVVLVRR
ADGTPAVLKLAPPRARPQSERAALAHWGGLGAVHLLESEAEDGALLLERLHPDVSVRSLP
EAKALLEAAGTLRRLWVAPPAGHVFETVAERTGRQAAAMRAGAGTDPEAAPLVEAALAAR
AELLAAPPEQLLLHGTFRQSKVLSGERMPWLAVGPDPVVGESAFDLARLVRDRVEDLIAA
SSGPSTTRRRIKRLAESLEVDQERLRGWTLFRAVESGVRARRVGREKDAELLLEFASWL
Download sequence
Identical sequences H2JZ46
WP_014675343.1.21199 WP_014675343.1.57224 gi|474985080|ref|YP_007695546.1| gi|386842871|ref|YP_006247929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]