SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014676493.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014676493.1.21199
Domain Number - Region: 3-117,191-309
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000157
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014676493.1.21199
Sequence length 382
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MQAYDLATGKVAWTFTPAALSDARTGVFVVTVGGREQVLLARQGKTSGDGLKQSAPTVTV
DIIPADSPAKATAAHHLDLPVPSDRALSFAASGSGFLVGAADHGTYSQATVIDPATGAKR
SVTAKDVTVPGCGGATCTLRATPAFATSAGVVSTYQQTTGCDRWGNGSGQPCTTGFQVGD
AWTSTTTAPRGMHTGIPLAVTGKYLIAAWHTSDSQTDQPALSADSKTTFTVQDLATGKRI
ASVSCTSADQLTLQPGSAQSSTRTSANGRYLVSGQTAFDLNSRTGRCYTSSASSKGIDFT
AVGDDGTAYGLIHTGDGSDASSLYGRLPIAPDGTDSTEQGARVDLAAGSAKALSEAAEVP
IYLAASDGVFRTGDVLAVYARR
Download sequence
Identical sequences H2JW98
gi|386844025|ref|YP_006249083.1| gi|474986236|ref|YP_007696702.1| WP_014676493.1.21199 WP_014676493.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]