SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014676820.1.28171 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014676820.1.28171
Domain Number - Region: 15-42
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0232
Family Cytochrome c3-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014676820.1.28171
Sequence length 60
Comment MULTISPECIES: hypothetical protein [Streptomyces]; AA=GCF_001514055.1; RF=na; TAX=1903; STAX=1903; NAME=Streptomyces corchorusii; strain=DSM 40340; AL=Scaffold; RT=Major
Sequence
MSSVNDALEDARLTYEQHMRTCRQCHADAAPCAVAKHLLRMYNLARRDRMRAGGPDTSTA
Download sequence
Identical sequences A0A117QJ61 H2K2N6
gi|474986563|ref|YP_007697029.1| gi|386844353|ref|YP_006249411.1| WP_014676820.1.21199 WP_014676820.1.28171 WP_014676820.1.57224 WP_014676820.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]