SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014676890.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014676890.1.21199
Domain Number 1 Region: 846-910
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.03e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0059
Further Details:      
 
Domain Number 2 Region: 11-211
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000804
Family RecA protein-like (ATPase-domain) 0.065
Further Details:      
 
Domain Number 3 Region: 525-626,786-815
Classification Level Classification E-value
Superfamily TPR-like 0.00000133
Family Tetratricopeptide repeat (TPR) 0.069
Further Details:      
 
Weak hits

Sequence:  WP_014676890.1.21199
Domain Number - Region: 425-479,591-699,776-812
Classification Level Classification E-value
Superfamily TPR-like 0.0152
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014676890.1.21199
Sequence length 915
Comment transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MAGSGGPLSRSGLRGREAELEVLRTLIDAVARTGSGALAVLRGEPGIGKTTLLTEVVTGA
EAAGFSVGYGKADELHHLVPLSSLATCVLHGDRPLLSGDALVDLAHRHDQRIWLVERLAE
AIEDRAGGAPVLIALDDVQWADPLSRFALQQLPSRLRTSPVLWLLTERQGVGGPAEEIVA
AVADELPVRTVSLGPLSGAAIGQLAGDTLGAAVDERVRELLAGAGGNPFLAVEMLAGLRT
TDASGEPVPPGLVVGVRGRLGSLHPDTLRFLQMGSVLGRRFGFQDAAALCGRPSVALLPA
LEEALRAGLLEDDGDQLVFRHDLLRQAVYVDIPPSARKVLHREAAGRLVAAGHQPIDVVS
HILRGAQPGDEEAVALLRRAAADVLPVTPGLAADLMTRALDLVPVARPLWFAVGEQAIVS
LTRAGRNREALATGDRLLACRPPMETFGRLHAALGGTLWNLDLADELRRRAEAALAVGGA
APEVEARLAGLRALALSRAHDLAPARQAGEDALRAAVVTGDREAHVQALFALGEIALNAG
ENALALKRFTALSAVDPTFFPEEIVAYQHMDDFDTSERLLAKAADESGGIREGMLLWAQG
QQHLELGRLDDAEADFVTMERLEDEVQAHVQQVNGRVIRSRIALLRGDREAARQHLAEAR
QRLAVKPNPGNTAAVRFLEAVHAEVDGDAERAVDRVRQVQREGPFLRWRLLRTWVGTAIR
VALRGADRALAEDLASQAEAHAARNPAVPTATGLAARARGLVCDDPVLLERSVVLLRHSP
RPLVRAAASADLGRALLATGRRTEAVAALTKAQAAFAASGAHAAAAHVQRDLRRAGAGGR
RTADEQRPVQGWEALTVSEKKVARLIAEGHSNRTAAELLVVSPHTVNTHLTSAFRKLSVN
SRVQLANLVMALPDE
Download sequence
Identical sequences H2K4F8
WP_014676890.1.21199 WP_014676890.1.57224 gi|386844423|ref|YP_006249481.1| gi|474986634|ref|YP_007697100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]