SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014676934.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014676934.1.57224
Domain Number 1 Region: 164-367
Classification Level Classification E-value
Superfamily Lysozyme-like 9.56e-70
Family Family 19 glycosidase 0.00000891
Further Details:      
 
Domain Number 2 Region: 31-150
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.55e-40
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014676934.1.57224
Sequence length 367
Comment endochitinase [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MHLGRMLAASVAACLAVLCAVTPAQAADGQITGLAGKCVDVAGANSANGTAVQLYDCNGT
NAQRWSNPGDGTLRALGKCLDVVDRGTADGAAVQLWDCSGGVNQQWVVTAAHDIVNPAAN
KCLDVRDNNSANGTRLQIWSCTGGANQKWNAPASGGGGTTPSGFVVSEAQFNQMFPNRNP
FYTYSGLTAALSAYPAFANTGSDTVKKQEAAAFLANVSHETGGLVYIVEQNTANYPHYCD
PNQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDPAVAWKTGLWY
WNTQSGPGTMTPHNAMVNGAGFGQTIRSINGSLECDGRNPAQVQSRVDAYQRFTQILGVS
PGGNLYC
Download sequence
Identical sequences H2K665
gi|386844467|ref|YP_006249525.1| WP_014676934.1.21199 WP_014676934.1.57224 gi|474986678|ref|YP_007697144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]