SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014701867.1.14155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014701867.1.14155
Domain Number 1 Region: 16-148
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-18
Family SMI1/KNR4-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014701867.1.14155
Sequence length 163
Comment MULTISPECIES: Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein [Pectobacterium]; AA=GCF_000024645.1; RF=na; TAX=561231; STAX=1905730; NAME=Pectobacterium parmentieri WPP163; strain=WPP163; AL=Complete Genome; RT=Major
Sequence
MINTAGIYMNTEKFVKIVDYVRNEKPNWFLTEDNFLAKKEDVMVIEREVNGSLPDEFVFF
SLKYKSGYFAFLNIYSLSPSSEWYILIKNREYQSVPECFLSFSDDETGGYYGFLKDNGHY
SNNVYFYDSSSNESPISMEKNFFDFVIDKAFQPDHFKLTLTEV
Download sequence
Identical sequences A0A0H3IEH9 D0KCA4
gi|261823493|ref|YP_003261599.1| WP_014701867.1.14155 WP_014701867.1.78307 561231.Pecwa_4272 gi|470156857|ref|YP_006285359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]