SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014701895.1.78307 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014701895.1.78307
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000131
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014701895.1.78307
Sequence length 147
Comment beta-1,3-glucan biosynthesis protein [Pectobacterium sp. SCC3193]; AA=GCF_000260925.1; RF=na; TAX=1166016; STAX=1166016; NAME=Pectobacterium sp. SCC3193; strain=SCC3193; AL=Complete Genome; RT=Major
Sequence
MAELISPQKKLTPQEMSDFESIFSVSIPDSFKDHYLKINGGFVSESDVEAELWGLPVNGF
NPIKHGKLTIERLIEDIHEIKPNNGKNGVWGYKQFVPFSYDLGGNIIFISLKYDDWGEVH
LYAPDGGNIINIDSSFTSFLRRLYKMD
Download sequence
Identical sequences A0A0H3IBQ6
WP_014701895.1.78307 gi|470156885|ref|YP_006285387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]