SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014720555.1.24104 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014720555.1.24104
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.09e-45
Family SMI1/KNR4-like 0.000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014720555.1.24104
Sequence length 135
Comment MULTISPECIES: cell wall assembly protein [Pseudomonas]; AA=GCF_001020625.1; RF=na; TAX=294; STAX=294; NAME=Pseudomonas fluorescens; strain=AU10414; AL=Contig; RT=Major
Sequence
MEEIIEQLREANEPVPVPLELPDEDLLVEIEEQLFIDIPFVFREFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVDRSLIPICQDGDDYYCVEEDGTVVLWSAEEELVTEET
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0D1PIG8 A0A0Q8AYS2 A0A0W0N8X3 A0A1D9ILU3 A0A1G3FC58 A0A1H1LEE0 A0A1H2PDV0 A0A1Q5WUH1 A0A1T1I4B7 A0A1Y3L9Y1 A0A270PKI8
gi|387896467|ref|YP_006326764.1| WP_014720555.1.100003 WP_014720555.1.14628 WP_014720555.1.24104 WP_014720555.1.24311 WP_014720555.1.26096 WP_014720555.1.27209 WP_014720555.1.28219 WP_014720555.1.35520 WP_014720555.1.40252 WP_014720555.1.45299 WP_014720555.1.46713 WP_014720555.1.47021 WP_014720555.1.50491 WP_014720555.1.50741 WP_014720555.1.53651 WP_014720555.1.5379 WP_014720555.1.54408 WP_014720555.1.5466 WP_014720555.1.54996 WP_014720555.1.59207 WP_014720555.1.65701 WP_014720555.1.67036 WP_014720555.1.68974 WP_014720555.1.69624 WP_014720555.1.72327 WP_014720555.1.72379 WP_014720555.1.7443 WP_014720555.1.83830 WP_014720555.1.8532 WP_014720555.1.90343 WP_014720555.1.93164 WP_014720555.1.95948 WP_014720555.1.96784 WP_014720555.1.97743 WP_014720555.1.98156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]