SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014737399.1.39459 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014737399.1.39459
Domain Number - Region: 11-106
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014737399.1.39459
Sequence length 136
Comment hypothetical protein [Thermogladius calderae]; AA=GCF_000264495.1; RF=representative genome; TAX=1184251; STAX=1200300; NAME=Thermogladius calderae 1633; strain=1633; AL=Complete Genome; RT=Major
Sequence
MIVREFKSVGELIKFIDEQINSYRALLAEFLRRLEDVRVRSEQEKKLKDLLKNLGVAETK
KSTVIDLKDSKLIIDPSAEEESKVIEETVERLNKNIQVLQSIRKTLDPLANLDIEAKITV
VLRDGIPASVLIKLGS
Download sequence
Identical sequences I3TEG1
WP_014737399.1.39459 gi|389861047|ref|YP_006363287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]