SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014740383.1.28377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014740383.1.28377
Domain Number 1 Region: 81-213
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-26
Family GntR ligand-binding domain-like 0.0096
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.7e-16
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014740383.1.28377
Sequence length 234
Comment GntR family transcriptional regulator [Modestobacter marinus]; AA=GCF_000306785.1; RF=representative genome; TAX=477641; STAX=477641; NAME=Modestobacter marinus; strain=BC501; AL=Complete Genome; RT=Major
Sequence
MSGPDALTRSVLADQVKERLLEAILDGSYPPDSRIVETAVAKELGTSQAPVREALRGLEA
LGIVEITPFRGARVRRLDVAELLEAYVVRSAIEVLGARLAVARLTDDDVAAIARIGEDMR
RVADAADGRALAIVDASFHEKIMSLSGNSTLLRVWRSLEPMSRTYITLVGPNSDPQWTCG
LHDPILEGIHRRDADAVVAAIERHFDQVRERLAGSLAGVAEQQDSAAQPATGTS
Download sequence
Identical sequences I4EWM8
WP_014740383.1.28377 gi|389864036|ref|YP_006366276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]