SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014740418.1.28377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014740418.1.28377
Domain Number 1 Region: 89-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.37e-27
Family GntR ligand-binding domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 21-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.78e-16
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014740418.1.28377
Sequence length 242
Comment GntR family transcriptional regulator [Modestobacter marinus]; AA=GCF_000306785.1; RF=representative genome; TAX=477641; STAX=477641; NAME=Modestobacter marinus; strain=BC501; AL=Complete Genome; RT=Major
Sequence
MTEARAVREVSAGGDFGGELLSATVKRLVLDRIVGGHYRPGERIVEFKLAKELGLSQSPV
REALRELAAVGIVTIHPRRGARVRLPSAKELVDVSVVRSEVDALAARLAAGRIADDTLDA
LEGLVAEMLERLEAEDFPGVTEADVRFHQLIAEASENHALQRAFDQLAPFARTFITLTLP
GVDVRGIVAEHRPILDALRARDAERAATAAREHQLSVSELLQMHFPAALGDPATGQDGDT
DG
Download sequence
Identical sequences I4EWR3
WP_014740418.1.28377 gi|389864071|ref|YP_006366311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]