SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014751908.1.62074 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014751908.1.62074
Domain Number 1 Region: 17-193
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.79e-39
Family YhhF-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014751908.1.62074
Sequence length 202
Comment methyltransferase [Advenella kashmirensis]; AA=GCF_000219915.2; RF=na; TAX=1036672; STAX=310575; NAME=Advenella kashmirensis WT001; strain=WT001; AL=Complete Genome; RT=Major
Sequence
MKPANRPAGTSGKRQTIRIIGGQYRRSQIPVVDADGLRPTSDRIRETLFNWLNYLWDGRF
DDKSVLDLFAGTGALGFEAASRGAAHVQMAETSPAALATLRATRDKLQASQVRINSADAF
LMLKRMDASRFDLVMLDPPFAGKLFDRIFPFLPAIVKPGGLVYIESDQPEDPGSDFPAIR
QGKAGQVYYQLHEHLIAPHKSE
Download sequence
Identical sequences I3UFM9
gi|389873380|ref|YP_006380799.1| WP_014751908.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]