SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014767530.1.2099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014767530.1.2099
Domain Number 1 Region: 10-192,321-403
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.83e-63
Family Bacterial dinuclear zinc exopeptidases 0.00063
Further Details:      
 
Domain Number 2 Region: 192-320
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000000718
Family Bacterial exopeptidase dimerisation domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014767530.1.2099
Sequence length 410
Comment succinyl-diaminopimelate desuccinylase [Desulfurococcus amylolyticus]; AA=GCF_000231015.2; RF=na; TAX=768672; STAX=94694; NAME=Desulfurococcus amylolyticus DSM 16532; strain=DSM 16532; AL=Complete Genome; RT=Major
Sequence
MTISQIYEIAKKILVDSIKFPTVLGEAYEDMIDYYREQLSEYGIHVTIHRVPDEFLRKTL
PREFNPEKPRFILLARIGNGEKVLQFNGHYDVVSPGEGWEMPPFEPVVRDDLVYGRGATD
MKGGIASILTALISLVQERREPSVIIEVALVPDEEIGGRTGTGYLVNELGSRPDYVIIAE
PSGLDNMYIGHRGNVWGIIRVHGKQAHGSAPWLGDNAFEKMLVFAQEFLKRYRERVSSRK
SNYLYEDERAAYPTITPGGLLIAPGSINIVPGTAGFSIDRRLIVEERVEDVIGEIQELLG
QVSRELNIDSSFTLVESSPPAFTPPDNKYTQILGEIIRKNTGREPRKTICIGGLDLRYYT
IKGIPAVSYGPGEVGLAHKPNEHIRISDVVRVSKIYVDFAKRFEKIQVDT
Download sequence
Identical sequences I3XRQ6
WP_014767530.1.2099 gi|390938467|ref|YP_006402205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]