SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014768164.1.2099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014768164.1.2099
Domain Number 1 Region: 9-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-67
Family G proteins 0.00000538
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-52
Family Translational machinery components 0.0000212
Further Details:      
 
Domain Number 3 Region: 260-383
Classification Level Classification E-value
Superfamily Translation proteins 3.14e-29
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 629-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.55e-21
Family EF-G/eEF-2 domains III and V 0.0055
Further Details:      
 
Domain Number 5 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.58e-19
Family EF-G/eEF-2 domains III and V 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014768164.1.2099
Sequence length 736
Comment elongation factor EF-2 [Desulfurococcus amylolyticus]; AA=GCF_000231015.2; RF=na; TAX=768672; STAX=94694; NAME=Desulfurococcus amylolyticus DSM 16532; strain=DSM 16532; AL=Complete Genome; RT=Major
Sequence
MVKFKQTSEVLKIMGNIEQIRNIGITAHVDHGKTTLSDSLLSAAGLISEKIAGQALALDY
LDVEQKRQMTVKAANASLYHEYKGKPYLINLIDTPGHVDFQSKTIRALRVIDGAIVVVDA
VEGVMTQTEMYLRVALEERVRPVLFINKIDRLIKELRLSPTEIQQRLVQIVRDVNTLIAT
YADKEFQKAWLLDPMKGQVAFGSARDRWGLTIPLVQQKGIKFSDIVDVYTRGKEAVAELQ
KTAPLHEAILDMVVKHVPNPREAQRYRIPKIWHGDLNHEIVKYLIEADPNGPLVMLINDI
RVDPHAGLVATGRIYSGTLRPGEEVWLVNARVPQRVLQVSLYMGPYRELADEITAGNIAA
ALGLEKARSGETVVSMKYKDTMTPFEKLKMITESVVTVAIEPKNPQQTTKLIDALYKLHL
EDPSLIVKINEETGEYLLSGVGTLHIEIALTLLKDLYGLEVVTSPPVIVYRETIRDRSQV
FEGKSPNKHNKFYISVAPLNEETLRLLSEGIIMEDMDARERAKILREQAGWDADEARRIM
AIDENLNILIDMTTGVQYLREVKDTIIQGFRLAMREGPLAMEPVRGVKVVLHDAVIHEDP
AHRGPAQIFPAVRNAIFAGFLTARPTILEPILKLDIRSPMEYIGNISSVITKKRGKLIEV
QQMETTARVIAEIPVSESFDIADMLRNVTAGKAIWGQEFSRWAPVPENMLMDLIAKIRTR
KGLKPEPPKPEDFLSP
Download sequence
Identical sequences I3XTK3
gi|390939114|ref|YP_006402852.1| WP_014768164.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]