SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014825556.1.101568 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014825556.1.101568
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.35e-41
Family N-utilization substance G protein NusG, N-terminal domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 118-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.46e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014825556.1.101568
Sequence length 175
Comment transcription termination/antitermination protein NusG [Desulfosporosinus acidiphilus]; AA=GCF_000255115.2; RF=representative genome; TAX=646529; STAX=885581; NAME=Desulfosporosinus acidiphilus SJ4; strain=SJ4; AL=Complete Genome; RT=Major
Sequence
MAKDWFVIHTYSGYENKVKMNLEKRVESMNMEEKIFRVLVPMEDEVEFKNGKEKVTKRKV
YPGYVLVEMEMTDDSWYVVRNTPGVTGFVGTGTKPIPLLDQEVIQILQQMGMDDLRAKID
FEVNQTVQVIAGPFKDFVGVVREILPDKGKLRVEVSMFGRETPVELDFGQVQKLD
Download sequence
Identical sequences I4D169
WP_014825556.1.101568 gi|392423881|ref|YP_006464875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]