SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014844244.1.91183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014844244.1.91183
Domain Number 1 Region: 198-353
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 6.8e-77
Family RalF, C-terminal domain 0.0000000866
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily Sec7 domain 1.57e-59
Family Sec7 domain 0.00000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014844244.1.91183
Sequence length 398
Comment RalF protein, translocated into host cells by the Dot/Icm system [Legionella pneumophila]; AA=GCF_900060375.1; RF=na; TAX=446; STAX=446; NAME=Legionella pneumophila; strain=2531STDY5467394; AL=Contig; RT=Major
Sequence
MHPEIEKAQREIIEAFNAKPKNGIEKIKEICEEYKISPNEEIAAFFHQQRKNLDLEAVGD
YLSGPEAENQQVLKAFTSQMDFNGQSFVEGLRIFLKTFKLPGEAQKIDRLVQSFSGAYSQ
QNPDAVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTMDGLKRNLRGGNNGGDFDAKFL
EELYSEIKAKPFELNFIKTSPGYELTSITLNKDSTFKKLDSFLHSTDVNINTVFPRIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDKQTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQ
TKESIDLAAKVAAGFSSPVKNFKATYDYEVGDLIKAYDKQKKLISTNKNTVIKGSMFRTP
NAEQQETSKSATRTLNTDYDINEDTVTRKDESRSSYKK
Download sequence
Identical sequences gi|397667680|ref|YP_006509217.1| WP_014844244.1.25422 WP_014844244.1.38809 WP_014844244.1.58065 WP_014844244.1.66942 WP_014844244.1.77360 WP_014844244.1.90718 WP_014844244.1.91183 WP_014844244.1.9970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]