SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014866246.1.51038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014866246.1.51038
Domain Number 1 Region: 205-321
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-22
Family Heme-binding PAS domain 0.04
Further Details:      
 
Domain Number 2 Region: 103-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000185
Family Heme-binding PAS domain 0.08
Further Details:      
 
Domain Number 3 Region: 319-385
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000245
Family GAF domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014866246.1.51038
Sequence length 394
Comment signal transduction histidine kinase [Methanoculleus bourgensis]; AA=GCF_000304355.2; RF=representative genome; TAX=1201294; STAX=83986; NAME=Methanoculleus bourgensis MS2; strain=MS2T; AL=Complete Genome; RT=Major
Sequence
MSPNEFLLPFGIIASTLVALGTTAYCLSSGVFVVCSHLFYIPIVLAAYRHPERGVGIAVA
LAAAHLAEVLLLSPGGVPEIANALVWAGVFLLVAAVVSHLAGRLRLREGRYRGIFETSGA
GIFLFSPDDRKVGEMNRQCAAMLGYPDGEVLDVTAFWPGYPGNPAPVTNQDCEFIRRDGT
SCPVLLSTSLLPDQEMNCAVVTGMTEQKRMENLLRRSEETFRVILNTVDVGIILTDPGRR
IIEVNDAMVRLCGGAAREDLIGRDPETLFAERDLAMIRACRERVLHGEVLAPVECTLCRF
DGSEWPAEVSVTLLAKDGDARFVDRFQERYPGHDDPTIRSFAAAPIPGDDGPVGCIAVAS
RTRETIPEDERLILATISEGLGSAVVKGMLLEGT
Download sequence
Identical sequences I7LLD5
WP_014866246.1.51038 gi|397779512|ref|YP_006543985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]