SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014866379.1.51038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014866379.1.51038
Domain Number 1 Region: 248-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.76e-30
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 2 Region: 124-249
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.36e-23
Family N-terminal PAS domain of Pas kinase 0.035
Further Details:      
 
Domain Number 3 Region: 622-765
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-22
Family Histidine kinase 0.0093
Further Details:      
 
Domain Number 4 Region: 4-140
Classification Level Classification E-value
Superfamily CheY-like 9.11e-21
Family CheY-related 0.0026
Further Details:      
 
Domain Number 5 Region: 388-566
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000000502
Family GAF domain 0.012
Further Details:      
 
Weak hits

Sequence:  WP_014866379.1.51038
Domain Number - Region: 548-620
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00589
Family Homodimeric domain of signal transducing histidine kinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014866379.1.51038
Sequence length 787
Comment C4-dicarboxylate transport sensor protein dctS [Methanoculleus bourgensis]; AA=GCF_000304355.2; RF=representative genome; TAX=1201294; STAX=83986; NAME=Methanoculleus bourgensis MS2; strain=MS2T; AL=Complete Genome; RT=Major
Sequence
MSGSLRVLLIGASPGDVLGIQEMLRGCGREIELIHCERLEDGLALASGGAVEVVLLDLDL
PENQATTCLDRLRRTAPDVPIIVLTAEGDDRAALRAMQHGAQDYLARERIDAELLCRSIK
YALERTRAELALRHSEAMYRRLVENLNEGVLAVDEAGLITFANPRMGEILGYPAGRLIGL
PISVFFDTADGAVSGTRNPFCRQTDRRQEFELDLLASDGRRVHVLVVTSPVTDAAGAFGG
CLAGVLDITDRKEAELALRQSEQKYRLVVESLSEGIWVIDQDARTLFVNPRMAEMLGYAP
EGMIGRQFYSFIPPSCSATIQDRLTRRRDGIREQYECEFIRKEGDRITALLIASPFMDDS
GEFRGSIAGVMDITERKRAEEEIRIRSEQLMVLNRIISVSATSLSLAEHLEESLEKTLEL
MGFHVGIVYMLDADRKRALLQYQRGVPPSCMPRNRVVKIHHWPFNFIFVAGQPRYIERHP
DLNSIEAGILRELDVSALACIPLIAEAVVVGAVYAGSRTKESFSREERTLLETIGKEIGS
GILKGMLHKRLEAANREANLYLDIMTHDIRNTENVSGLYAGLLIEMLEGEAALYARKIES
GVRRSKEILGNVSTIRRIHHESPDLSPVDLDVVVKEEVAAFPDVAIEVEGMSRQVWADDL
LPEVFTNLIRNAVRLGGPGIEIAIRVEDYDGESVLVSVEDTGPGIPDPLKGSILHLFERG
WIEGCGDGLGLFIVRTLVERYGGTLRVEDRVEGRPDLGAAFRFTLREVLSSGSDEDSDRC
PVGEECE
Download sequence
Identical sequences I7LIX4
WP_014866379.1.51038 gi|397779645|ref|YP_006544118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]