SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014868271.1.51038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014868271.1.51038
Domain Number 1 Region: 311-431
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000274
Family BphP N-terminal domain-like 0.052
Further Details:      
 
Domain Number 2 Region: 178-264
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000082
Family Heme-binding PAS domain 0.033
Further Details:      
 
Domain Number 3 Region: 81-190
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000999
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 
Domain Number 4 Region: 10-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000322
Family ArsR-like transcriptional regulators 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014868271.1.51038
Sequence length 469
Comment histidine kinase [Methanoculleus bourgensis]; AA=GCF_000304355.2; RF=representative genome; TAX=1201294; STAX=83986; NAME=Methanoculleus bourgensis MS2; strain=MS2T; AL=Complete Genome; RT=Major
Sequence
MSEYQDKFSKIIDLLEDQAPQGLSISAIARELGMNRATVSKYLEMLQSSGDVSMQRFGRS
KLYTPAQRVPLSELFDRLSNAIVILDADLHILMVNTSFIKTLGIHRERNLIGASLFDLNL
RIFSDPAIRRNIERIRQSGTYLAEMQHIEDSTNHIYLLEFAPTVSHVGKPGIMVSLRDIT
AWKNAEAALKNSEKKIRTIFGTVPSGIVLFTADGTILNANRASLELLGLKTFQELVSGNI
FDISCYKGKVLELIRQGKVAETELACDFDRLRREQRIPSTRSGIAYFDIVFTPITLDGGG
VPHEFAILFKDVTTERLARKELAFKETRYRSFFENTCNGVLIYEPINDGGEYIFKDVNRA
TEKILQMKKQDLIGRKLFEVFPDLPDPDVRDALIRVLKTEKPEFLLPLQYRKEEDSPWIW
HYIFKLPSGEIASFMIDVSDAVRKDAGAPLQACSARGKHSRDRAGSSLS
Download sequence
Identical sequences I7LNQ3
gi|397781542|ref|YP_006546015.1| WP_014868271.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]