SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014868286.1.51038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014868286.1.51038
Domain Number 1 Region: 58-263
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.42e-16
Family Terpene synthases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014868286.1.51038
Sequence length 402
Comment hypothetical protein [Methanoculleus bourgensis]; AA=GCF_000304355.2; RF=representative genome; TAX=1201294; STAX=83986; NAME=Methanoculleus bourgensis MS2; strain=MS2T; AL=Complete Genome; RT=Major
Sequence
MDGRVTSLVTRMSGAVREMAVVDGETAYIRDPVFGIVRNRVHAEICKAMLRAGGDPLVGP
ILNYVVECQNPEGSWNEVHVNYNQPSALITAFIGDALLEAADWYPHEEELVKARDHVLAA
EKRPGYFLKSAQYTADHLNVDASCGAFLARYAERYDDRDARAAAMRAAENVVRHQRDDGV
YPYAIDKGTYPYVFDLPCVHYQGVTMYYLAKANDVLREDRIDESLARGAQWLEAALCPCG
RFNWSGSGLSFAYHLSGAYAFAHASFIYTSRNNGHYREHAGLCLNRLEETVREGLALRWE
PSSWSSLPPSVVAAAKVASIGEYPVRHRAFRFGYAVYRQVARRRYSETAETRSFKALCRL
LRIRSSTVEPSKNFPDLFMTSEVLDCLSQSGIWGNSHETGIT
Download sequence
Identical sequences I7L194
WP_014868286.1.51038 gi|397781558|ref|YP_006546031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]