SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014962338.1.70052 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014962338.1.70052
Domain Number - Region: 4-29
Classification Level Classification E-value
Superfamily RING/U-box 0.00138
Family RING finger domain, C3HC4 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014962338.1.70052
Sequence length 57
Comment MULTISPECIES: hypothetical protein [Nitrosopumilus]; AA=GCF_000328945.1; RF=na; TAX=1027374; STAX=1027374; NAME=Nitrosopumilus sp. SJ; strain=SJ; AL=Contig; RT=Major
Sequence
MDAKCPECEKVAILDDKITNVRCPHCNFEADYDTYIEIMKDQAINMSSEYIPDRPGL
Download sequence
Identical sequences K0B4Y5
WP_014962338.1.70052 WP_014962338.1.82955 gi|407461570|ref|YP_006772887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]