SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014963600.1.82955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014963600.1.82955
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily RING/U-box 4.59e-22
Family Zf-UBP 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014963600.1.82955
Sequence length 85
Comment MULTISPECIES: zinc finger UBP-type protein [Nitrosopumilus]; AA=GCF_000328925.1; RF=na; TAX=1027373; STAX=1027373; NAME=Nitrosopumilus sp. AR; strain=AR; AL=Contig; RT=Major
Sequence
MTTECNHFVEEKKGITPNTVSCEECEKEHLPVVAIRMCLTCGHVGCCDSSIGKHATKHFE
ETGHPVMKAIPGDIWKWCYHHKEYY
Download sequence
Identical sequences K0B7W0
WP_014963600.1.70052 WP_014963600.1.82955 gi|407462842|ref|YP_006774159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]