SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014964631.1.82955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014964631.1.82955
Domain Number 1 Region: 11-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-46
Family Ribonuclease PH domain 1-like 0.0000057
Further Details:      
 
Domain Number 2 Region: 155-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-24
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014964631.1.82955
Sequence length 244
Comment MULTISPECIES: exosome complex exonuclease Rrp41 [Nitrosopumilus]; AA=GCF_000328925.1; RF=na; TAX=1027373; STAX=1027373; NAME=Nitrosopumilus sp. AR; strain=AR; AL=Contig; RT=Major
Sequence
MGGRDATMVLLDENGIRCDGRKVDEPRRIMIKAGGLKNADGSAYIEFGDNKILVGVFGPR
DVHPKHMSNTDTGILRVRYHMEPFSVGERKNPAPSRREIEISKVIKEALEPAVMLEKFPR
TAVDVFIEVLQADGGTRCAALTAASVALADAGIPMRDMVAAIAAGKVADTVILDVNNEED
QAGQADMPIGYMPSLKKITLLQLDGVLTPEEYKKCVDVGVKGCELVYELQKKALHDKYFG
KGDE
Download sequence
Identical sequences K0B9T4
gi|407464319|ref|YP_006775201.1| WP_014964631.1.40567 WP_014964631.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]