SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014964632.1.40567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014964632.1.40567
Domain Number 1 Region: 8-172,200-217
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-46
Family Ribonuclease PH domain 1-like 0.00000682
Further Details:      
 
Domain Number 2 Region: 186-270
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.15e-23
Family Ribonuclease PH domain 2-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014964632.1.40567
Sequence length 272
Comment MULTISPECIES: RNA-binding protein [Nitrosopumilus]; AA=GCF_000299395.1; RF=na; TAX=1229909; STAX=1229909; NAME=Candidatus Nitrosopumilus sediminis; strain=AR2; AL=Complete Genome; RT=Major
Sequence
MTSTSVIDELKRTQILELLEQGKRVDGRALDEAREIKIETNAIPKANGSARVFLGDTEVI
CGVKIQPDRPFPDTGDKGLFICTAELLPLSHPTVETGPPQPPVIELARVVDRGIRESHMV
DVSQLVIEKDKSVIGVFADNVVVDYDGNLFDACSYAATAALLTTKTPKWNWTDDSPVLAE
GEDRPLPITTIPVSVTMGKIGNYIVVDPNGDEWESMDARVTITTDSDGNICALQKGGSDG
FTQDEINQCGEISVRIGAKIREKLKAAQKDSQ
Download sequence
Identical sequences K0BB86
WP_014964632.1.40567 WP_014964632.1.82955 gi|407464320|ref|YP_006775202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]