SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014964671.1.40567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014964671.1.40567
Domain Number 1 Region: 3-218
Classification Level Classification E-value
Superfamily Aquaporin-like 4.71e-46
Family Aquaporin-like 0.0000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014964671.1.40567
Sequence length 227
Comment MULTISPECIES: major intrinsic protein [Nitrosopumilus]; AA=GCF_000299395.1; RF=na; TAX=1229909; STAX=1229909; NAME=Candidatus Nitrosopumilus sediminis; strain=AR2; AL=Complete Genome; RT=Major
Sequence
MAYSNLQIFTVELIGTFILVMFATGSIVYDAEFFDGALGIPFASVAPFIALLIGVYSFGK
ISLAHFNPAVTVGYYITGHISKIQVVYYFAAEIIGALLGSLFVLSFIGDKANLGANAPNY
DFSIFVIFPVEVLASAMLMGVIFYVVYTKGLRGFSGVAIGGIVGLDILFLAFISGASMNP
ARALAPALLSGTFENLWLYWTAPYVGTMIVAVLFRKKFQAQRAANYE
Download sequence
Identical sequences K0B9Y3
gi|407464359|ref|YP_006775241.1| WP_014964671.1.40567 WP_014964671.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]