SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014964745.1.82955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014964745.1.82955
Domain Number 1 Region: 5-230
Classification Level Classification E-value
Superfamily Aquaporin-like 1.57e-59
Family Aquaporin-like 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014964745.1.82955
Sequence length 234
Comment MULTISPECIES: glycerol transporter [Nitrosopumilus]; AA=GCF_000328925.1; RF=na; TAX=1027373; STAX=1027373; NAME=Nitrosopumilus sp. AR; strain=AR; AL=Contig; RT=Major
Sequence
MVNPRAYLAEAIATYGLVFFGPLSVILAVSAFGEELTTQSVLFISLGHGGAIALMVYAFG
HVSGAHINPAVTIPMIITKKIGIADGIGYIISQLIGAVAAAATLAAILPEVGAKVNFATQ
GGPSDLINNSIGSGFAIEAILTFFLVTVIFMVAVHKKATPGIQGLAIGGMVFLIHLVAVP
LTGASVNPARTFGPALISGFWEFHWLYWAAPILGGIIAGLIMNYVYTKPAEKEA
Download sequence
Identical sequences K0B8C3
gi|407464433|ref|YP_006775315.1| WP_014964745.1.40567 WP_014964745.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]