SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014965986.1.40567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014965986.1.40567
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-18
Family GHMP Kinase, N-terminal domain 0.0053
Further Details:      
 
Weak hits

Sequence:  WP_014965986.1.40567
Domain Number - Region: 198-254
Classification Level Classification E-value
Superfamily AF1531-like 0.0196
Family AF1531-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014965986.1.40567
Sequence length 304
Comment MULTISPECIES: GHMP kinase [Nitrosopumilus]; AA=GCF_000299395.1; RF=na; TAX=1229909; STAX=1229909; NAME=Candidatus Nitrosopumilus sediminis; strain=AR2; AL=Complete Genome; RT=Major
Sequence
MEATAFCPAHITGFFKAHLEGKHYNLENLGSMGAGFSIKEGVTTTVKVQAKDNQGSNFKI
TTKGYQADKTDVSQYVLNEFLKLGEFSTKFFDIRHEISIPVGYGLGSSSAVALSLSFALD
QALNTKLNKTMIGQIAHNAEVSCKTGLGDVLASYYGGFEIRIKPGAPGIGQVKKITTDKI
SVIMICFSPISTNKFIKERLSQINGLGGKMVNKLLESKNYEHFQDMSLEFAKYVDVMTPR
MQKIVEELSENNIKCGIALFGETIFSMIPQKIESKVLEILQKYSNDGIIIKSELDDIGAR
VLNN
Download sequence
Identical sequences K0BEZ7
gi|407465680|ref|YP_006776562.1| WP_014965986.1.40567 WP_014965986.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]