SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014965986.1.82955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014965986.1.82955
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-18
Family GHMP Kinase, N-terminal domain 0.0053
Further Details:      
 
Weak hits

Sequence:  WP_014965986.1.82955
Domain Number - Region: 198-254
Classification Level Classification E-value
Superfamily AF1531-like 0.0196
Family AF1531-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014965986.1.82955
Sequence length 304
Comment MULTISPECIES: GHMP kinase [Nitrosopumilus]; AA=GCF_000328925.1; RF=na; TAX=1027373; STAX=1027373; NAME=Nitrosopumilus sp. AR; strain=AR; AL=Contig; RT=Major
Sequence
MEATAFCPAHITGFFKAHLEGKHYNLENLGSMGAGFSIKEGVTTTVKVQAKDNQGSNFKI
TTKGYQADKTDVSQYVLNEFLKLGEFSTKFFDIRHEISIPVGYGLGSSSAVALSLSFALD
QALNTKLNKTMIGQIAHNAEVSCKTGLGDVLASYYGGFEIRIKPGAPGIGQVKKITTDKI
SVIMICFSPISTNKFIKERLSQINGLGGKMVNKLLESKNYEHFQDMSLEFAKYVDVMTPR
MQKIVEELSENNIKCGIALFGETIFSMIPQKIESKVLEILQKYSNDGIIIKSELDDIGAR
VLNN
Download sequence
Identical sequences K0BEZ7
WP_014965986.1.40567 WP_014965986.1.82955 gi|407465680|ref|YP_006776562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]