SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014966010.1.40567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014966010.1.40567
Domain Number - Region: 34-61
Classification Level Classification E-value
Superfamily RING/U-box 0.00971
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014966010.1.40567
Sequence length 63
Comment MULTISPECIES: hypothetical protein [Nitrosopumilus]; AA=GCF_000299395.1; RF=na; TAX=1229909; STAX=1229909; NAME=Candidatus Nitrosopumilus sediminis; strain=AR2; AL=Complete Genome; RT=Major
Sequence
MKIECGCHCIKCKSTDLESNRIGEIEKDGYYDMHHTCKKCNTHFDHLDGEVFLTCEKCSY
SSS
Download sequence
Identical sequences K0BF12
gi|407465705|ref|YP_006776587.1| WP_014966010.1.40567 WP_014966010.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]