SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014974183.1.85428 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014974183.1.85428
Domain Number 1 Region: 8-78
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000981
Family Occludin/ELL domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014974183.1.85428
Sequence length 79
Comment hypothetical protein [Leuconostoc carnosum]; AA=GCF_000300135.1; RF=representative genome; TAX=1229758; STAX=1252; NAME=Leuconostoc carnosum JB16; strain=JB16; AL=Complete Genome; RT=Major
Sequence
MKILDNIKNLSAQLKEISRLLNQLKAQQKNLVEQVDQIKTTSDEIQVEIEKMNFKNKPHL
DRIKETTEHLNDQLSKFKA
Download sequence
Identical sequences K0DCA3
WP_014974183.1.85428 gi|407718165|ref|YP_006795570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]