SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015043955.1.71633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015043955.1.71633
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.84e-45
Family N-utilization substance G protein NusG, N-terminal domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 118-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.73e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015043955.1.71633
Sequence length 175
Comment MULTISPECIES: transcription termination/antitermination protein NusG [Dehalobacter]; AA=GCF_000305815.1; RF=na; TAX=1131462; STAX=1131462; NAME=Dehalobacter sp. CF; strain=CF; AL=Complete Genome; RT=Major
Sequence
MTKNWYVIHTYSGYENKVKTNLEKRVESMNMEDKIFRVLVPMEDEIEIKNGKKKISKRKV
FPGYVLVEMDMTDDSWYVVRNTPGVTGFVGSGSKPIPLLDQEVAVILRQMGLEKIRTKID
VVVGQSVRVISGPFKDFIGVVKEVLEEKQKVRVSVSMFGRETPVELEFGQVEKLD
Download sequence
Identical sequences K4LH16 T0JJN8
gi|410661527|ref|YP_006913898.1| gi|410658540|ref|YP_006910911.1| WP_015043955.1.6016 WP_015043955.1.71633 WP_015043955.1.88763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]