SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015056403.1.27722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015056403.1.27722
Domain Number 1 Region: 280-414,737-846
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-18
Family ABC transporter ATPase domain-like 0.032
Further Details:      
 
Domain Number 2 Region: 10-182,210-256
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000000000589
Family PHP domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015056403.1.27722
Sequence length 879
Comment MULTISPECIES: hypothetical protein [Gammaproteobacteria]; AA=GCF_002202195.1; RF=na; TAX=573; STAX=573; NAME=Klebsiella pneumoniae; strain=AR_0139; AL=Complete Genome; RT=Major
Sequence
MGTVFAQGAQWVRADFHLHTRADREFKYTGDDNFYNSNYVDALEKAGIHLAVITNHNKFD
FEEFKALRKTAQKKDIALLPGVELSVNDGANGIHTLVVFSDDWLADGHDHINPFLGVAFE
GKVPAQYEQENGRSSLSLLETIKKLESYHRDFFLVFAHVEAPSGLWAELDGGRLAELGQN
EFFRRRTLGFQKVRTYNKQQEKSKPCRTKTQQHLGDWYPAELEGCDAKCIEDIGQGKACY
LKLGELSFEAVKFALSDPASRVAMEPPKHQGSFIRGIHFDGGILDGKTLHFSPELNTLIG
IRGSGKSSILEAVRYALDIPRGEKAQDTKYKDELIRHTLGSGGKVTLTACDVYGQEFTIS
RIFREAPNVYLDGKLQPGVSIRETVLRRPIYFGQKDLSSTGEGFETDLVEKLVGEKLRML
RDEIETQRQHVRDAASRWLKLSNTAELRRDHESQLTDANFRLKKFEEYGVADKLQKRLGY
QQDATALTRMKDRADSFVIALGQLISEHEDDLRNATSYVSKQNPGFFTAYYAEFANLVAK
VDQLKKIEQEARAITARLQAKQGEFDDARQSLQEEFAQVERQLAQELKQTGMTAIQPDDF
LTQQQRKTKAEQMLEALAKQETQQSSIRDVLFAEIDKLNGLWLREFSAIKAELDRVNAGH
TALQIEADFKGDKEAAIGFMQQLFKGSNIRETTLRAVMEDYADFGGLLRDLPNALKKAGS
TPEVFEKTFMQNLVEFVTCQVPNRFVIRYRGKELKHHSLGQRASALLLYVLSQRQNDVII
IDQPEDDLDNQTIYDDVIKLLREMKPHAQFIFATHNANFPVLGDAEQVHACRYQDEQVAV
QSGSIDARPVQDAIINIMEGGQEAFNRRKEVYNLWKPQS
Download sequence
Identical sequences A0A2K2UM85 G3F9U0 G9FJR1
gi|410496344|ref|YP_006903373.1|NC_019045 gi|410502948|ref|YP_006940003.1|NC_018994 gi|410593310|ref|YP_006953231.1|NC_019069 gi|410656129|ref|YP_006958720.1|NC_019153 WP_015056403.1.100465 WP_015056403.1.10134 WP_015056403.1.101702 WP_015056403.1.11315 WP_015056403.1.11742 WP_015056403.1.12086 WP_015056403.1.14171 WP_015056403.1.1604 WP_015056403.1.18171 WP_015056403.1.20215 WP_015056403.1.21228 WP_015056403.1.23522 WP_015056403.1.26950 WP_015056403.1.27545 WP_015056403.1.27722 WP_015056403.1.28742 WP_015056403.1.29829 WP_015056403.1.32797 WP_015056403.1.34706 WP_015056403.1.39637 WP_015056403.1.41368 WP_015056403.1.44136 WP_015056403.1.48904 WP_015056403.1.52054 WP_015056403.1.52425 WP_015056403.1.53122 WP_015056403.1.53967 WP_015056403.1.61272 WP_015056403.1.62469 WP_015056403.1.6302 WP_015056403.1.66415 WP_015056403.1.67805 WP_015056403.1.68362 WP_015056403.1.77467 WP_015056403.1.80829 WP_015056403.1.82240 WP_015056403.1.858 WP_015056403.1.87063 WP_015056403.1.87150 WP_015056403.1.87315 WP_015056403.1.87628 WP_015056403.1.87929 WP_015056403.1.90636 WP_015056403.1.91213 WP_015056403.1.91301 WP_015056403.1.91676 WP_015056403.1.91729 WP_015056403.1.9216 WP_015056403.1.92901 WP_015056403.1.93252 WP_015056403.1.97025 WP_015056403.1.97463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]