SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015080398.1.50365 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015080398.1.50365
Domain Number 1 Region: 1178-1409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-41
Family Legume lectins 0.00032
Further Details:      
 
Domain Number 2 Region: 1403-1478
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.000000000432
Family Hypothetical protein PA1324 0.012
Further Details:      
 
Domain Number 3 Region: 1515-1598
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000135
Family Cadherin 0.019
Further Details:      
 
Domain Number 4 Region: 769-860
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.011
Further Details:      
 
Domain Number 5 Region: 1067-1156
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000068
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 567-652
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000288
Family Cadherin 0.0076
Further Details:      
 
Domain Number 7 Region: 667-755
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000484
Family Cadherin 0.0085
Further Details:      
 
Weak hits

Sequence:  WP_015080398.1.50365
Domain Number - Region: 1610-1697
Classification Level Classification E-value
Superfamily PKD domain 0.0141
Family PKD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015080398.1.50365
Sequence length 3130
Comment YD repeat-containing protein [Anabaena sp. 90]; AA=GCF_000312705.1; RF=na; TAX=46234; STAX=46234; NAME=Anabaena sp. 90; strain=90; AL=Complete Genome; RT=Major
Sequence
MFYSSINPQDLSIFSTGISTSYSDGAYGLSSEVFNPLTHIQNTSAIFSIESELVNGITNY
SLPEKIISADYLIREKFSNFITNSNIDDWLGIAYGGDYQINLAQSLLQSQINDGFKDVQI
SVINSEILGNANGAYAESINTIFLGNEFVNSNSTEVIAQVITEEFGHFLDAQINETDSQG
DEGDIFAKLVFNQSLTSEELNSLKAENDHGIIQFNDQFINIEKSAFKITNNIGETLAVTE
DTTLVFQWTQREAQYNNEVGIIVFDNPEGKIDGVSPQQAGYFQKVLNSEKSEVIFSKGSS
AGNWKQLDFKAGDYVGFYLIQNGNSAEYLNNPNCINIFSSITSANTDNFDHVLSTNLGNN
IYRFNWEDLTGGGDKDFNDVVFNVFEKGFKAGENNTQTVPLTVEFLSNEAAYKNEIGFYY
VDDINGNINGISPDDANYAKEVFKQDNYQVTFGEGNYSGVKEYSLEGNQYIGWYLIADNT
SQGFLQTNPNNNPNGEALAYFSYAEANPDNLNHLIHYSSNQMGWEDIFDGGDKDFNDLVF
RFELGNPISEHNDENQAPRELKLTPSSKQENVNHNTVIGVFNTIDPDLENIFTYNLISGE
GDSDNIAFTITGNELKIKDSPNFEDKPNYRIRVRTTDVKGLSYEQSLIVDIINVNETLTD
IALDNDIVEENISGAAIATISITDPDTVATFRNNTVTVNDSRFEVINNNGIIQLKLKGGQ
SLDYETEPTIAIALTATDNSNSSLTYSENFTINVTNVNETPTNIALNNNSVTENSGGAVI
GNITVTDPDQVATFRNNTVTVSNNRFEVINNNGILQLKLKGGQSLDYETEPTIAIALTAT
DNSNSSLTYSENFTINVIDVDENIETPTISAALTNDTGVSNSDRLTLDPTVNGQTQGATS
LQGNLNGNGFVDISSALNEDGSFTISFEQYDVLSNDTLPNGIYLLELKAKNSSGQESEIV
TVSFTLDWIAPPLSFELASESDTGEKGDNVTTAYKVNLIGQTDPGLEVMLVETQQKAVAD
DTGAFRFNDVALPSAGKAPYSLMVSDAAGNQGQTRQFLTREGINGAPEITSTPEIVFDTT
QQTTYTYQIAAIDPDNDALTYTLLNALQEVEIDEDGLLSFTPSGVLKPFYNFNLEVSDGR
GGKDTQTFTVDVMNENLGTIRGTKWEDLNKNGLRDLAIFSNFDDISRLSLKGDTTIVESD
LSGETALRLTRNRGFRVDTSGNALLQNPFDLVDEDGNILSFSTKFEFAITSSMGISDEDG
VGADGITFIISPTDTLGSYGGGLGYGGLLNSIAIELDTFNNNPFGISDVSGNHIGIDLNG
DLNSIAQTNIDGRFNDGEIWTVWIDYNGESQTLEARVAQGDTRPQEVSVSTIVNIPEVLD
QENFFVGFGSGIAAGWGNHDILSWEFGLNEPGLAGVSVYLDSNNNGKLDPDEPVKLTAED
DLSTLDIDETGKYEFNNLLSGNYTVREIIPPDFKQTFPTGSISGPDFYTVELDVGGIVEN
INFGNVRSTSENRSPLIISEPVTLTVPDVPYRYQIRATDANGDTLTYTLKNPPDGMAIDE
NGLITWNPNAIGNNAVAIEVSDGKGGVATQNYSLNVIEVTVDTEVPQVYLGFSSNVFERG
ETINLQIQGFDNVGLADLDLSFDGNSLTLDPDYAIVGGISTASVQLTQPGIFTVVATATD
LAGNKDTETLSVRVLDPNDTSAPIAKLDLSGFDPLNLVIRQKTEVKGKINDQNLEFYRVE
LAPVSLIDLSNPAAKDPDYITIAEGTGNIDGILASIDPALYRNDNYFVRIYAQDINGNIT
VEGFGVGIDSQTKPGEFSLDYTDLSIPLTGIPIEVTRRYSSLDANFQGDFGYGWELGLQD
AQIVESAPTGVDLNFDDFFGGNSFTEGTRVTLTTPDGRRVGFTFTPEVFSASAGIFLGPD
YYAWQPKFTPDPGVYETLEVPYVPIMRLKDGSFGIYLFGLTYNPSDYILTTKDGTKYTYD
QYEGLETIVDRNANKLTYTDNGITSSTGAKIDFIRDTQGRITEIIDPDGKSLKYSYDTNG
NLIEFGDRTNNETTFKYQAQRDHYLTKVIDPLNRTSVRTEYDENGQISKIIDANGNELEI
NFDAAASSQTIKDPFGNNITRIFDKQGNVIQEVDQLGGITLRTYNANNNLLSETDPEGNT
TSYTYDNRGNKLIETDGEGNTKTYTYNAKNDILTETDALGNKTTYTYDVSGNLTQREDAE
GNVTTYNYGANGLLTKVIDANNKTSTFSYDNFGNLTELIDPTGAKTTFTYDNNGRVKSVT
DALGAITNYIYDAQGRLIEKADPEGSSCGCARGITKTEYNAAGEKIAETDALGRRTEYRY
NERGLLIETILPDSTPDILTDNPRTKNEYDALDRLTIFTDELGRKTYYVYDKLGRQIEVI
HPDSTPNNLEDNPRTKKEYDKAGLVIAEIDELGNRTELKYDNAERLISRTNALNEVTTYT
YDADGRQISMTDALGRKTTYSYDNLDRLDSTIYANNTAMTTSYDGLGRVIAKTDLAGNTT
NYEYDALGRLTTVIDALNQRTEYKYDAVGNLIEQKDANGNITKFEYDSLRRLQATILPEG
QENETIHNKIGNLIEVTDFNGVVTTYKYNERNWLIEKSFSDGTPTETFTYTLTGELVTVT
DNRGVTSYVYDERDRLISRTEPDSRKIQYTYDNAGNILTLIVPSSTTTYTYDKINRIDTV
KDADNGVTDYDYDAVGNLIKTEFGNGVIENQQYDLLNRLTYLENRNQTDVISSYTYTLDA
MGNRLKVEENDGRIVEYSYDDIYRLTQEKTTDSVVGNKTIQYQFDAVGNRLQKIDSVEGT
TSYSYDDNDRLLQETLGGKVTNYQYDNEGNLKAKVENGTTQAEYEWNAKGELTAVEVTEN
GETGRIEFEYDHNGIRVAINVDGEETRFLIDNNQQQYAQVIEYQVNGDVKTTYTHGWDLI
SQDNGNNRIYYQVDGLGSARLLTDNNGAVVVEYDYDAYGNLTRKVGDADNNYLFAGEQFD
DAVDGYYLRARYYDSATGRFVSTDPFEGYNNQPITLHDYLYAGVNPVNAIDPSGEVSMLE
YTILSTTILAKQIAASYICPDSSFGTATTVATFFLGLALHYYQVSLLLSLAIGNIAATGV
LAISPLCKLL
Download sequence
Identical sequences K7W2J0
gi|414077737|ref|YP_006997055.1| WP_015080398.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]