SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015115301.1.60169 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015115301.1.60169
Domain Number 1 Region: 423-660,687-705
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000157
Family Galacturonase 0.053
Further Details:      
 
Domain Number 2 Region: 19-263
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000455
Family Galacturonase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015115301.1.60169
Sequence length 838
Comment hypothetical protein [Nostoc sp. PCC 7107]; AA=GCF_000316625.1; RF=na; TAX=317936; STAX=317936; NAME=Nostoc sp. PCC 7107; strain=PCC 7107; AL=Complete Genome; RT=Major
Sequence
MATFNVTNTKNSGLGSLQQAILNANTSAGKDLIRFTGGLFTDNIADTISLGGSSLFITDD
LSIDGRGSNLLTISGNYNFAQDNNLSRVFEIASGITVDIEGLTIANGYAADTRGGGGVYN
AGNLTLRNVTISNNFSGGQDSSGNNGGGIYNSNSGVLRLNNSTVTANYAGQVDADGILYT
SDGGGIYNAGIVTLNNSAINGNSAGYYNDFYFPDNLGNGAGVYNTGTLTANNSTINNNRG
TGDGTGIYSTGTVTLSYGSVDNNESSNPFYNAFSGIVSNGSLTIRNSSVSSNRAIDVNGA
SSGIDSSGTLIISNSNIDNNQSFWSSGVLHSGTLTVTNSSINYNSGRNSSGLVANGTITI
DRSTINGNTSDYDFSNAGLVVRGTVRVNNSTISNNSSNSGSAGLRNSGNVTISNSTISSN
IGGLNFTGDINSNSIYNSASGNLTVIRSTITGNSNPDGAANGTIVNDGTVTIISSTISDN
SAGLGGGILNNGTAIVVNSTINNNTAGIGGGINNSGTLTLVNTTISSNQSYSEGGGIYNS
GTLTVSNSTIAFNKSYYDDENTVSSGAGIYNTATGTATIKNSIIAGNNDGISGAVNPDVV
GNFISNGYNLIGNLNGSTGFNPSEQLQVSISQVIDTILRDNGGLVKTHALVYGSPAINGG
NNADISADIADLDRDGNTTEGIPFDQRGTGYRRISNGRVDIGAYEASVINGTQYSDNLRG
TAINDLIAGLRGADVLTGGAGADSFVYTSIVDSGDTITDFAVGTDKIVLQALWRSLSLGS
LNFATAIAGGYLQLQTEGTETLVFIDLDGAAGQRLPLELLRLRNVSANTLNDSKNFVF
Download sequence
Identical sequences K9QI83
WP_015115301.1.60169 gi|427709881|ref|YP_007052258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]