SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015116474.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015116474.1.44015
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.06e-67
Family Decarboxylase 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015116474.1.44015
Sequence length 235
Comment orotidine-5'-phosphate decarboxylase [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MQKIIVPLDVANESDALTLIEKLKEVTFFKVGLELFTSCGPKIIKLLKSRQKKIFLDLKF
HDIPNTVKGGCRSAGRYGVDLLTIHAAAGKDALKAATEGLAEGAMQAGVEPPKLIAITLL
TSISSRQLAFDLKVPLELPEYALQMALLAKECGLNGAVCSPQEAAHLRDVCGDDFLLVCP
GVRPTWADKGDQKRTFTPAQALQAGADYLVIGRPITAADRPVLAWKKICEELTSS
Download sequence
Identical sequences K9R630
WP_015116474.1.44015 gi|427733899|ref|YP_007053443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]