SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015116707.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015116707.1.44015
Domain Number 1 Region: 93-220
Classification Level Classification E-value
Superfamily CheY-like 8.4e-42
Family CheY-related 0.00028
Further Details:      
 
Domain Number 2 Region: 228-402
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.85e-34
Family HD domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015116707.1.44015
Sequence length 408
Comment two-component system response regulator [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MIQWKSNYTGSTELKVAGSNPTNRYNRVGKNHALPTESERHSSELSTHDLKVQQTDSEDS
SNYGLKNTNSNLLFSATLQNKEYSLDCFENDVPKVLVVDDHAASRMTAVALLGMEGYEVI
EAESGSVAVHLVSEKQPDLILLDVMMPEMDGFEVCQLLKQDEQTRLIPVIFITALNDRRS
RIRGIEVGADDFLSKPFDRVELAARVKSLVRQKRLNEDLDHAEKALFSIARAIESRDPNT
GDHCERLVNLGKAFGEYLGLSRNQVRDLMWGGYLHDIGKVGISDSVLLKKGKLTPAEWEE
MRQHVLIGEQICQPLRSMRGVIPIIRSHHERWDGSGYPDGLKENEIPLLAQVFQMIDIYD
ALTSERPYKKAFTPTEALSIMMEETDKGWRDKKLMQQFTEFISTINHS
Download sequence
Identical sequences K9R702
WP_015116707.1.44015 gi|427734132|ref|YP_007053676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]