SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015118396.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015118396.1.44015
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily CheY-like 9.11e-40
Family CheY-related 0.00048
Further Details:      
 
Weak hits

Sequence:  WP_015118396.1.44015
Domain Number - Region: 170-371
Classification Level Classification E-value
Superfamily PP2C-like 0.000366
Family PP2C-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015118396.1.44015
Sequence length 374
Comment serine phosphatase RsbU, regulator of sigma subunit [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MFQILVIDDDPAVQILLKRMLEKQGYKVVAVSNGEEGIAQAIVSHPALIICDWLMPGLSG
IDVCRYIKKDPNLSTTFFILLTSLDSVADRVKGLDAGADDFITKPIEQNEMQARVRAGLR
LHQMSRDLKAQKQILEAELSEAADYVRSLLPMPMVHPFNINYTFIPSQQLGGDCFDYYWL
DPDYLAIYLLDTAGHGLKATLPSISVLNLLRSRALKDLNYYQPKEVLNALNSTFQMNYQN
DKYFTIWYGVYNIVKRELIYSSAGHPPAILLSNNNDIQLLKTPGMPVGMFPEVQYTNGFC
KIEKNSTLYIFSDGAYEISLSDGQLMGLENFIQRVTRLYHFSSSPLENILNCLVDLNSKN
TFDDDLSILQIGFN
Download sequence
Identical sequences K9RBK1
WP_015118396.1.44015 gi|427735824|ref|YP_007055368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]