SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015119106.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015119106.1.44015
Domain Number 1 Region: 33-367
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.16e-43
Family Filamentous hemagglutinin FhaB, secretion domain 0.0062
Further Details:      
 
Domain Number 2 Region: 548-670
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.075
Further Details:      
 
Domain Number 3 Region: 427-545
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000628
Family P22 tailspike protein 0.047
Further Details:      
 
Domain Number 4 Region: 731-853
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000016
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 5 Region: 982-1073
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000502
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 6 Region: 858-985
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000691
Family P22 tailspike protein 0.087
Further Details:      
 
Weak hits

Sequence:  WP_015119106.1.44015
Domain Number - Region: 368-443
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000116
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015119106.1.44015
Sequence length 1308
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MLIRTRFYKGLRLGLAGISSCISVFLITNLTLAQQSNITPDNTLGGENSRVNSNVDINGI
SADKIDGGARRNSNLFHSFSEFNINNGQAVYFANPDGVENILTRVTGGNPSSILGTLGVD
GAANLFLINPNGIVFGENASLDLQGSFVGTTASGLQFGEQGNFSATNAEIPGSLTVNPSA
LFFNQVEASGGIINKSQAPAGLTVPNGKSLLLVGGDINLDGGSLTALEGNIELASLVLPG
KVGLKISGDTFSLNIPEDLERGDISLTNQSFISVFGAGGGNFTINARNLEISNSFILAGI
SFNLDNPNAQAGDVNLNATGLIELKDGAVIANNVDSQGNAGDINIKGDSIAVTNGSQIIT
DTFGFGNAGNITLNAADNITFDNLSKITSDVASNAVGKGGDIQITTGTLNVSNSAQISTT
TSGQGDGGNITINAREKVIFSDLGSADSNSFDNAVGNGGDIRINTGELLLKNGGSLSSAN
SGAGNAGNIFLDVRETITIDSAASNSSSSRIGTFASNNNAGNIDIKTGSLFLTNGGQIDA
GALGQENADNLTNAGKITINAADTVKIDGALTGLFTELSSGKGKGGDIEIKTNSLSVTNG
ALLFSLTDGRGNAGNITINASDTVTFDKLGVAFTLVNTNAIGDGGNIQITTGSLFVNDNS
QINSGIFGKGDAGKIEINARNLISLSNFGSILSSVNQGGEGKGGQIKLIASSLDLNNGSQ
ISANTLGKGDAGKIEINASDKITIQVTDSNEDSSGVFSAVASNGEGNGGEIKVTTSSLFL
DNGGLFSTVTNGKGDAGKIEINATDLISLSNSGSILSSVNQGAEGKGGEIKLSASNVDLN
NNSRITASTLGKGDAGKIELNATDSISLFNSSFIDSNIRAGAEGKGGSIDINTQTLRLTD
GSQINSAVFGAEGNFPGGKGKGGEININASESVTLSGIGSTGFSSGIFTSTAIGASGDAG
NITVTTDNFGIKDSAIVNATTSNEGNAGNITFNTNTFAATNGGVVATATDSSGNAGTIKL
FVKDKIVLTGSELLTGLFASTSANSTGEGGSIFIDPRLVIIENGARVSVDSNGSKDGGDI
SLQAGTLQLNNGFITAETASTQGGNINLQISDLLLLRNESQITTTAGTAQAGGDGGNITI
NSKFIVAPQNENSDITANAFSGNGGTVNINSSGIFGIETQESLTIKSDITASSEEAIAGE
TNINTDDTSSIQNSFTELSPNIDTDAIIASSCIARGNKRQENTFRNTGSGALPTNRAGNI
FVSKYATGKVRTVESNNPTWKKGDAIVEPQGLYRLKNGELLLSRECTN
Download sequence
Identical sequences K9RDH6
gi|427736541|ref|YP_007056085.1| WP_015119106.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]