SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015119959.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015119959.1.44015
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily YggU-like 9.81e-24
Family YggU-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015119959.1.44015
Sequence length 74
Comment hypothetical protein [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MQKIVKVKPNSKKQEIIEEDDGSLTIRLKSPPVDGKANEELIKILSKKFNVPKSYIRIKS
GASSRQKLIEIDTD
Download sequence
Identical sequences K9RGG2
WP_015119959.1.44015 gi|427737397|ref|YP_007056941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]