SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015123197.1.5248 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015123197.1.5248
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00204
Family Putative zinc binding domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015123197.1.5248
Sequence length 162
Comment hypothetical protein [Synechococcus sp. PCC 6312]; AA=GCF_000316685.1; RF=na; TAX=195253; STAX=195253; NAME=Synechococcus sp. PCC 6312; strain=PCC 6312; AL=Complete Genome; RT=Major
Sequence
MSDSVVNRPNPKSQLQLEEVYTCPVCQHGQISQMVLMEAFSCNFCRHILSVNLERQTVRL
EDSSQAFQWQWDGQKWQSLSQQNIPFTYTLAVVAVALILLPPGLVWLGYYTFPPLPDSSW
TWFPLAWAGLTLVTHLGLVLGILLNAYPSFAFWRWRLSRPSR
Download sequence
Identical sequences K9RQ97
WP_015123197.1.5248 gi|427711572|ref|YP_007060196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]