SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015124582.1.5248 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015124582.1.5248
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.73e-73
Family Histidine biosynthesis enzymes 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015124582.1.5248
Sequence length 257
Comment 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase [Synechococcus sp. PCC 6312]; AA=GCF_000316685.1; RF=na; TAX=195253; STAX=195253; NAME=Synechococcus sp. PCC 6312; strain=PCC 6312; AL=Complete Genome; RT=Major
Sequence
MDVIPAIDLLGGQCVRLFQGNYDQAQVFNTNPRQVAESFVSQGATRLHLVDLDGAKSGQP
VNYDIIAEIAQTLPIPVQVGGGLRTKAQVQALLGLGVERAILGTVALKQPELVAELAAEF
PGQIWVGIDAKNGRVATHGWLETSEITAIQLAQQMQRLGIGGIIYTDIARDGTLQGPNLD
ALKELADQVEVSIIASGGVSSLTDILDIFALTGRGIVGAIVGKAIYTGAVDLAEAIKAVG
IGRWQDVPPDLGQVTWA
Download sequence
Identical sequences K9RUS2
WP_015124582.1.5248 gi|427712958|ref|YP_007061582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]